Abc-Type Transporter, Periplasmic Subunit Family 3

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Abc-Type Transporter, Periplasmic Subunit Family 3
  Conformer 1
(PDB) 		4prs (B)
  Conformer 2
(PDB) 		4psh (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 128 1.27   4 - 94   188 - 224
2 93 0.69   95 - 187

Sequence


           ____________________________________________________________________________________________94__________________________ 
 4prs(B) : AIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELKIVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDFRPKTYEDLVGKTV 
         :                                                                                                                          
 4psh(A) : *IDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELKIVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDFRPKTYEDLVGKTV 
           ____________________________________________________________________________________________94__________________________ 

           _____________________________________________________________184___________________________________________              
 4prs(B) : AVQIGTTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNPDLVISSGVLSSEQYGIAVRKEDTDLLEFINSVLRELKKSPYDVLIEKWFSE              
         :                                                                                                                          
 4psh(A) : AVQIGTTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNPDLVISSGVLSSEQYGIAVRKEDTDLLEFINSVLRELKKSPYDVLIEKWFS*              
           _____________________________________________________________184___________________________________________              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		84.8
Translation
(A) 		2.1
Closure
(%) 		86.3
Bending Residues
( green ) 		  94 - 95
  184 - 189
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download