Hemophore Hasa

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Hemophore Hasa
  Conformer 1
(PDB) 		2cn4 (A)
  Conformer 2
(PDB) 		1dk0 (B)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 122 0.43   50 - 171
2 20 1.34   30 - 49

Sequence


           ______________________________________________49________________________________________________________________________ 
 2cn4(A) : AFSVNYDSSFGGYSIHDYLGQWASTFGDVNHTNGNVTDANSGGFYGGSLSGSQYAISSTANQVTAFVAGGNLTYTLFNEPAHTLYGQLDSLSFGDGLSGGDTSPYSIQVPDVSFGGLNLS 
         :                                                                                                                          
 1dk0(B) : AFSVNYDSSFGGYSIHDYLGQWASTFGDVNHTNGNVTDANSGGFYGGSLSGSQYAISSTANQVTAFVAGGNLTYTLFNEPAHTLYGQLDSLSFGDGLSGGDTSPYSIQVPDVSFGGLNLS 
           ______________________________________________49________________________________________________________________________ 

           _____________________________________________________                                                                    
 2cn4(A) : SLQAQGHDGVVHQVVYGLMSGDTGALETALNGILDDYGLSVNSTFDQVAAATA                                                                    
         :                                                                                                                          
 1dk0(B) : SLQAQGHDGVVHQVVYGLMSGDTGALETALNGILDDYGLSVNSTFDQVAAATA                                                                    
           _____________________________________________________                                                                    

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		176.7
Translation
(A) 		-0.4
Closure
(%) 		91.9
Bending Residues
( green ) 		  49 - 52
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download