Acrb

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Acrb
  Conformer 1
(PDB)
2dr6 (A)
  Conformer 2
(PDB)
2dr6 (B)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 196 1.4   41 - 129   618 - 619   676 - 725   813 - 867
2 364 2.1   4 - 37   343 - 561   868 - 920   927 - 983   1019 - 1033
3 138 1.6   139 - 182   286 - 338   562 - 567   921 - 926   990 - 1018
4 288 1.09   183 - 285   568 - 617   622 - 669   726 - 812

Sequence


           ___________________________________37___________________________________________________________________________________ 
 2dr6(A) : MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQ 
         :                                                                                                                          
 2dr6(B) : MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQ 
           ___________________________________37___________________________________________________________________________________ 

           ______129__________________________________________________182__________________________________________________________ 
 2dr6(A) : EVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGTPPVKGQQLNASIIAQTRL 
         :                                                                                                                          
 2dr6(B) : EVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGTPPVKGQQLNASIIAQTRL 
           ______129__________________________________________________182__________________________________________________________ 

           __________________________________________285__________________________________________________338______________________ 
 2dr6(A) : TSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEFNGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILVFLVMYLFLQ 
         :                                                                                                                          
 2dr6(B) : TSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEFNGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILVFLVMYLFLQ 
           __________________________________________285__________________________________________________338______________________ 

           ________________________________________________________________________________________________________________________ 
 2dr6(A) : NFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL 
         :                                                                                                                          
 2dr6(B) : NFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL 
           ________________________________________________________________________________________________________________________ 

           ________________________________________________________________561___567_______________________________________________ 
 2dr6(A) : SVLVALILTPALCATMLKfGWFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDEDQGVFMTMVQLPAGATQERTQKVLNEVTHYYLTKEKNNVESVFAVNG 
         :                                                                                                                          
 2dr6(B) : SVLVALILTPALCATMLKfGWFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDEDQGVFMTMVQLPAGATQERTQKVLNEVTHYYLTKEKNNVESVFAVNG 
           ________________________________________________________________561___567_______________________________________________ 

           617_________________________________________________669_____________________________________________________725_________ 
 2dr6(A) : FGFAGRGQNTGIAFVSLKDWADRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDQE 
         :                                                                                                                          
 2dr6(B) : FGFAGRGQNTGIAFVSLKDWADRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDQE 
           617_________________________________________________669_____________________________________________________725_________ 

           ___________________________________________________________________________812__________________________________________ 
 2dr6(A) : KAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQLASKLPTG 
         :                                                                                                                          
 2dr6(B) : KAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQLASKLPTG 
           ___________________________________________________________________________812__________________________________________ 

           __________867__________________________________________________920___926________________________________________________ 
 2dr6(A) : VGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLRP 
         :                                                                                                                          
 2dr6(B) : VGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLRP 
           __________867__________________________________________________920___926________________________________________________ 

           ______983_______________________________1018__________________                                                           
 2dr6(A) : ILMTSLAFILGVMPLVISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRRRFSRK                                                           
         :                                                                                                                          
 2dr6(B) : ILMTSLAFILGVMPLVISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRRRFSRK                                                           
           ______983_______________________________1018__________________                                                           

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
3 2 17.0 0.5 3.4   338 - 343   561 - 562   920 - 921   926 - 927   983 - 994   1018 - 1019 Bending Region Analysis
1 2 20.9 1.4 42.3   37 - 41   867 - 868 Bending Region Analysis
1 3 18.5 -5.6 61.3   129 - 139 Bending Region Analysis
1 4 19.1 -0.5 93.1   617 - 622   669 - 680   725 - 726   812 - 813 Bending Region Analysis
3 4 14.0 -0.4 33.9   182 - 183   285 - 286   567 - 568 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 4

Conformer 2 Contact:
Residue 4 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 4

Conformer 2 Contact:
Residue 4 ———› Residue 3

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download