Atp-Dependent Hsl Protease Atp-Binding Subunit Hslu

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Atp-Dependent Hsl Protease Atp-Binding Subunit Hslu
  Conformer 1
(PDB)
1im2 (A)
  Conformer 2
(PDB)
1qg4 (A)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 35 10.7   80 - 115
2 26 3.19   53 - 79

Sequence


           _________________________________________________________________________79_____________________________________________ 
 1im2(A) : SEtPREIVSELDQHIIGQADAKRAVAIALRNRWRRqLQEPLRHEVTPKNILiGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAkLVRQQEIAKNRARAED 
         :                                                                                                                          
 1qg4(A) : *****************************************EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKYGGLRDGYYIQAQ 
           _________________________________________________________________________39_____________________________________________ 

           ________________________________________________________________________________________________________________________ 
 1im2(A) : VAEERlIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKeYSGADVSREGVQRDLLPLVEGSTVSTKHGvKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFER 
         :                                                                                                                          
 1qg4(A) : CAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVA 
           ________________________________________________________________________________________________________________________ 

           _________________________________________________________________________________________________                        
 1im2(A) : ILTEPHASLTEQYKALaTEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVeRLdKISFSASDnGQTVNIDAAYVADALGEVVENEDLSRFIL                        
         :                                                                                                                          
 1qg4(A) : QTT**********************************************************************************************                        
           _________________________________________________________________________________________________                        

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
160.4
Translation
(A)
6.4
Closure
(%)
99.9
Bending Residues
( green )
  79 - 85
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download