Atp-Dependent Metalloprotease Ftsh

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Atp-Dependent Metalloprotease Ftsh
  Conformer 1
(PDB)
1iy0 (A)
  Conformer 2
(PDB)
4ww0 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 164 1.25   150 - 324
2 68 0.66   325 - 392

Sequence


           ________________________________________________________________________________________________________________________ 
 1iy0(A) : ******TEAPKVTFKDVAGAEEAKEELKEIVEFLKNPSRFHEMGARIPKGVLLVGPPGVGKTHLARAVAGEARVPFITASGSDFVEMFVGVGAARVRDLFETAKRHAPCIVFIDEIDAVG 
         :                                                                                                                          
 4ww0(A) : MAKVYIEEKPKVTFKDVAGIEEVKEEVKEIIEYLKDPVKFQKLGGRPPKGVLLYGEPGVGKTLLAKAIAGEAHVPFISVSGSDFVEMFVGVGAARVRDLFETAKKHAPCMIFIDEIDAVG 
           ________________________________________________________________________________________________________________________ 

           _____________________________________________________324________________________________________________________________ 
 1iy0(A) : RKRnDEREQTLNQLLVEMDGFEKDTAIVVMAATNRPDILDPALLRPGRFDRQIAIDAPDVKGREQILRIHARGKPLAEDVDLALLAKRTPGFVGADLENLLNEAALLAAREGRRKITMKD 
         :                                                                                                                          
 4ww0(A) : R----eREQTLNQLLVEMDGFDTSDGIIVIAATNRPDILDPALLRPGRFDRQIFIPKPDVRGRYEILKVHARNKKLAKDVDLEFVARATPGLTGADLENLLNEAALLAARKGKEEITMEE 
           _____________________________________________________324________________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 1iy0(A) : LEEAAS****************************************************************************************************************** 
         :                                                                                                                          
 4ww0(A) : IEEALDRITmTISPKEKEKIAIHEAGHALMGLVSDDDDKVHKISIIPhIYDKKDLYNKILVLLGGRAAEEVFFGKDGITTGAENDLQRATDLAYRMVSMWGMSDKVGPIAIRRdTSPDLL 
           ________________________________________________________________________________________________________________________ 

           ________________________________________________________________                                                         
 1iy0(A) : ****************************************************************                                                         
         :                                                                                                                          
 4ww0(A) : REIDEEVRRIITEQYEKAKAIVEEYKEPLKAVVKKLLEKETITCEEFVEVFKLYGIELKDKCKK                                                         
           ________________________________________________________________                                                         

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
34.9
Translation
(A)
-0.6
Closure
(%)
7.4
Bending Residues
( green )
  324 - 326
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download