Camp-Dependent Protein Kinase Type I-Alpha Regulatory Subunit

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Camp-Dependent Protein Kinase Type I-Alpha Regulatory Subunit
  Conformer 1
(PDB)
1rgs (A)
  Conformer 2
(PDB)
2qcs (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 142 4.72   233 - 374
2 118 3.01   115 - 232

Sequence


           ________________________________________________________________________________________________________________________ 
 1rgs(A) : ***********************RKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPR 
         :                                                                                                                          
 2qcs(B) : KGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPR 
           ________________________________________________________________________________________________________________________ 

           ______________226_______________________________________________________________________________________________________ 
 1rgs(A) : AATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLM 
         :                                                                                                                          
 2qcs(B) : AATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLM 
           ______________226_______________________________________________________________________________________________________ 

           ___________________________________________________                                                                      
 1rgs(A) : NRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVS****                                                                      
         :                                                                                                                          
 2qcs(B) : NRPKAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSVA                                                                      
           ___________________________________________________                                                                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
143.6
Translation
(A)
-2.7
Closure
(%)
55.1
Bending Residues
( green )
  226 - 236
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download