Camp-Dependent Protein Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Camp-Dependent Protein Kinase
  Conformer 1
(PDB)
1stc (E)
  Conformer 2
(PDB)
1cdk (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 226 0.52   17 - 35   93 - 105   123 - 180   184 - 320
2 104 0.78   36 - 92   106 - 122   181 - 183   321 - 348

Sequence


           __________________________35_______________________________________________________92__________105______________122_____ 
 1stc(E) : *******VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGE 
         :                                                                                                                          
 1cdk(A) : KGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGE 
           __________________________35_______________________________________________________92__________105______________122_____ 

           __________________________________________________180___________________________________________________________________ 
 1stc(E) : MFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTW-lCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY 
         :                                                                                                                          
 1cdk(A) : MFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY 
           __________________________________________________180___________________________________________________________________ 

           ____________________________________________________________________318________________________________                  
 1stc(E) : EKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRV-iNEKCGKEFSEF                  
         :                                                                                                                          
 1cdk(A) : EKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF                  
           ____________________________________________________________________318________________________________                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
9.9
Translation
(A)
0.1
Closure
(%)
95.9
Bending Residues
( green )
  35 - 36
  92 - 93
  105 - 106
  122 - 123
  180 - 181
  183 - 185
  318 - 329
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download