Citrate Synthase (E.C.4.1.3.7)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Citrate Synthase (E.C.4.1.3.7)
  Conformer 1
(PDB)
1cts  
  Conformer 2
(PDB)
4cts (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 365 1.05   3 - 57   65 - 288   328 - 348   371 - 435
2 68 1.44   58 - 64   289 - 327   349 - 370

Sequence


           _______________________________________________________57_____64________________________________________________________ 
 1cts    : ASSTNLKDILADLIPKEQARIKTFRQQHGNTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGYSIPECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAAL 
         :                                                                                                                          
 4cts(A) : ASSTNLKDILADLIPKEQARIKTFRQQHGNTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGYSIPECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAAL 
           _______________________________________________________57_____64________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 1cts    : PSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGIHRTKYWELIYEDCMDLIAKLPCVAAKIYRNLYREGSSIGAIDSKLDWSHNFTNMLGYTDAQFTELMRLYLTIHSDHEG 
         :                                                                                                                          
 4cts(A) : PSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGIHRTKYWELIYEDCMDLIAKLPCVAAKIYRNLYREGSSIGAIDSKLDWSHNFTNMLGYTDAQFTELMRLYLTIHSDHEG 
           ________________________________________________________________________________________________________________________ 

           ______________________________________281___________________________________________327__________________348____________ 
 1cts    : GNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPHDPMFKLVAQLYKIVPNV 
         :                                                                                                                          
 4cts(A) : GNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPHDPMFKLVAQLYKIVPNV 
           ______________________________________281___________________________________________327__________________348____________ 

           _____368_____________________________________________________________________                                            
 1cts    : LLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLIKLVDSK                                            
         :                                                                                                                          
 4cts(A) : LLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLIKLVDSK                                            
           _____368_____________________________________________________________________                                            

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
21.7
Translation
(A)
-0.3
Closure
(%)
92.9
Bending Residues
( green )
  57 - 58
  64 - 65
  281 - 289
  327 - 328
  348 - 349
  368 - 371
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download