Citrate Synthase (E.C.4.1.3.7)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Citrate Synthase (E.C.4.1.3.7)
  Conformer 1
(PDB)
1cts  
  Conformer 2
(PDB)
1al6  
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 333 0.89   5 - 56   65 - 274   281 - 281   333 - 336   338 - 340   343 - 346   375 - 378   380 - 434
2 97 1.31   57 - 64   275 - 280   282 - 332   337 - 337   341 - 342   347 - 374   379 - 379

Sequence


           ______________________________________________________56______64________________________________________________________ 
 1cts    : ASSTNLKDILADLIPKEQARIKTFRQQHGNTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGYSIPECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAAL 
         :                                                                                                                          
 1al6    : **STNLKDVLASLIPKEQARIKTFRQQHGNTAVGQITVDMSYGGMRGMKGLIYETSVLDPDEGIRFRGFSIPECQKLLPKAGGGEEPLPEGLFWLLVTGQIPTPEQVSWVSKEWAKRAAL 
           ______________________________________________________56______64________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 1cts    : PSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGIHRTKYWELIYEDCMDLIAKLPCVAAKIYRNLYREGSSIGAIDSKLDWSHNFTNMLGYTDAQFTELMRLYLTIHSDHEG 
         :                                                                                                                          
 1al6    : PSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGINRTKYWEFVYEDAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDPQFTELMRLYLTIHSDHEG 
           ________________________________________________________________________________________________________________________ 

           _______________________________274___280_________________________________________________332_____340___346______________ 
 1cts    : GNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPHDPMFKLVAQLYKIVPNV 
         :                                                                                                                          
 1al6    : GNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLLWLSQLQKDLGADASDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPSDPMFKLVAQLYKIVPNV 
           _______________________________274___280_________________________________________________332_____340___346______________ 

           ___________374_378___________________________________________________________                                            
 1cts    : LLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLIKLVDSK                                            
         :                                                                                                                          
 1al6    : LLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTAGLEKLSAG*                                            
           ___________374_378___________________________________________________________                                            

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
19.6
Translation
(A)
0.0
Closure
(%)
84.7
Bending Residues
( green )
  56 - 57
  64 - 65
  274 - 276
  280 - 282
  332 - 338
  340 - 343
  346 - 347
  374 - 375
  378 - 380
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download