Citrate Synthase (E.C.4.1.3.7)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Citrate Synthase (E.C.4.1.3.7)
  Conformer 1
(PDB)
5csc (A)
  Conformer 2
(PDB)
6csc (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 315 0.8   6 - 56   65 - 274   279 - 281   343 - 345   383 - 431
2 107 2.13   57 - 64   275 - 278   282 - 342   346 - 382

Sequence


           ______________________________________________________56______64________________________________________________________ 
 5csc(A) : ASSTNLKDVLAALIPKEQARIKTFRQQHGGTALGQITVDMSYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKALPKGGgGE-PLPEGLFWLLVTGQIPTGAQVSWLSKEWAKRAAL 
         :                                                                                                                          
 6csc(B) : ***TNLKDVLASLIPKEQARIKTFRQQHGNTAVGQITVDMSYGGMRGMKGLIYETSVLDPDEGIRFRGFSIPECQKLLPKAGGGEEPLPEGLFWLLVTGQIPTPEQVSWVSKEWAKRAAL 
           ______________________________________________________56______64________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 5csc(A) : PSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGILRTKYWEMVYESAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDAQFTELMRLYLTIHSDHEG 
         :                                                                                                                          
 6csc(B) : PSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGINRTKYWEFVYEDAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDPQFTELMRLYLTIHSDHEG 
           ________________________________________________________________________________________________________________________ 

           ______________________________273_____281__________________________________________________________342__________________ 
 5csc(A) : GNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLGWLAQLQKAaGADAS---LRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPGDPMFKLVAQLYKIVPNV 
         :                                                                                                                          
 6csc(B) : GNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLLWLSQLQKDLGADASDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPSDPMFKLVAQLYKIVPNV 
           ______________________________273_____281__________________________________________________________342__________________ 

           ___________________382_______________________________________________________                                            
 5csc(A) : LLEQGAAANPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLIAL****                                            
         :                                                                                                                          
 6csc(B) : LLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTAGLEKLSAGG                                            
           ___________________382_______________________________________________________                                            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
16.0
Translation
(A)
0.5
Closure
(%)
83.4
Bending Residues
( green )
  56 - 57
  64 - 69
  273 - 279
  281 - 282
  342 - 346
  382 - 383
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download