Atp-Dependent Hsl Protease Atp-Binding Subunit Hslu

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Atp-Dependent Hsl Protease Atp-Binding Subunit Hslu
  Conformer 1
(PDB)
1qg4 (A)
  Conformer 2
(PDB)
1rrp (A)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 166 3.97   11 - 176
2 28 4.97   177 - 204

Sequence


           ________________________________________________________________________________________________________________________ 
 1qg4(A) : EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKYGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVD 
         :                                                                                                                          
 1rrp(A) : **QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVD 
           ________________________________________________________________________________________________________________________ 

           ________________________________________________176___________________________________                                   
 1qg4(A) : IKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT****                                   
         :                                                                                                                          
 1rrp(A) : IKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPD                                   
           ________________________________________________176___________________________________                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
111.5
Translation
(A)
-4.0
Closure
(%)
18.5
Bending Residues
( green )
  176 - 178
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download