Bisphosphoglycerate Mutase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Bisphosphoglycerate Mutase
  Conformer 1
(PDB) 		3nfy (A)
  Conformer 2
(PDB) 		1t8p (A)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 217 0.31   5 - 95   122 - 247
2 26 0.51   96 - 121

Sequence


           ____________________________________________________________________________________________95_______________________121 
 3nfy(A) : SKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNV 
         :                                                                                                                          
 1t8p(A) : SKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNV 
           ____________________________________________________________________________________________95_______________________121 

           ________________________________________________________________________________________________________________________ 
 3nfy(A) : TPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAI 
         :                                                                                                                          
 1t8p(A) : TPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAI 
           ________________________________________________________________________________________________________________________ 

           _________                                                                                                                
 3nfy(A) : QAAIKKVED                                                                                                                
         :                                                                                                                          
 1t8p(A) : QAAIKKVED                                                                                                                
           _________                                                                                                                

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.3
Translation
(A) 		0.3
Closure
(%) 		69.1
Bending Residues
( green ) 		  95 - 96
  121 - 122
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download