Bira Bifunctional Protein (Acts As Biotin Operon Repressor 3 And Biotin Holoenzyme Synthetase) (E.C.6.3.4.15)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Bira Bifunctional Protein (Acts As Biotin Operon Repressor 3 And Biotin Holoenzyme Synthetase) (E.C.6.3.4.15)
  Conformer 1
(PDB)
2ewn (A)
  Conformer 2
(PDB)
1bib (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 195 1.38   66 - 86   91 - 108   115 - 116   133 - 202   207 - 226   236 - 315
2 94 1.42   5 - 65   87 - 90   109 - 114   117 - 132   203 - 206   227 - 235

Sequence


           ______________________________________________________________65________________83_____90_______________108___114_______ 
 2ewn(A) : *DNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSLPEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSGDACIAEYQQAGRGRRGR 
         :                                                                                                                          
 1bib(A) : KDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSLPEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSGDACIAEYQQAGRGR--- 
           ______________________________________________________________65________________83_____90_______________108___114_______ 

           ________132___________________________________________________________________202_206________________225_______235______ 
 2ewn(A) : KWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRKLGADKVRVKWPNDLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAM 
         :                                                                                                                          
 1bib(A) : ---sPFGANLYLSMFWRLEQ-pAAAIGLSLVIGIVMAEVLRKLGADKVRVKWPNDLYLQDRKLAGILVELTG----aAQIVIGAGINMAM-----------wITLQEAGINLDRNTLAAM 
           ________132___________________________________________________________________202_206________________225_______235______ 

           _______________________________________________________________________________                                          
 2ewn(A) : LIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQDGIIKPWMGGEISLRSAE                                          
         :                                                                                                                          
 1bib(A) : LIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQDGIIKPWMGGEISLR***                                          
           _______________________________________________________________________________                                          

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
15.1
Translation
(A)
-0.3
Closure
(%)
29.5
Bending Residues
( green )
  65 - 66
  83 - 87
  90 - 91
  108 - 111
  114 - 117
  132 - 133
  202 - 203
  206 - 207
  225 - 227
  235 - 236
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

Glyoxylate reductase/hydroxypyruvate reductas

PyMOL Script

Download and extract PyMOL PML script file Download