Glutamate Receptor Subunit 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor Subunit 2
  Conformer 1
(PDB) 		1ftm (C)
  Conformer 2
(PDB) 		1my4 (C)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 156 0.39   6 - 107   115 - 115   137 - 142   171 - 171   194 - 198   209 - 210   219 - 257
2 98 0.27   108 - 114   116 - 136   143 - 170   172 - 193   199 - 208   211 - 218   258 - 259

Sequence


           _____________________________________________________________________________________________________107____114_________ 
 1ftm(C) : KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
         :                                                                                                                          
 1my4(C) : KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
           _____________________________________________________________________________________________________107____114_________ 

           __________136___142_________________________170____________________193__198_______208______217__________________________ 
 1ftm(C) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
         :                                                                                                                          
 1my4(C) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
           __________136___142_________________________170____________________193__198_______208______217__________________________ 

           ___________257____                                                                                                       
 1ftm(C) : QGLLDKLKNKWWYDKGEC                                                                                                       
         :                                                                                                                          
 1my4(C) : QGLLDKLKNKWWYDKGEC                                                                                                       
           ___________257____                                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		2.4
Translation
(A) 		0.1
Closure
(%) 		97.6
Bending Residues
( green ) 		  107 - 108
  114 - 117
  136 - 137
  142 - 143
  170 - 172
  193 - 194
  198 - 199
  208 - 211
  217 - 219
  257 - 258
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download