Glutamate Receptor 3

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor 3
  Conformer 1
(PDB) 		3dln (A)
  Conformer 2
(PDB) 		3dp4 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 139 0.19   9 - 110   217 - 253
2 112 0.2   111 - 216   254 - 259

Sequence


           ________________________________________________________________________________________________________110_____________ 
 3dln(A) : RTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
         :                                                                                                                          
 3dp4(A) : RTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
           ________________________________________________________________________________________________________110_____________ 

           __________________________________________________________________________________________216___________________________ 
 3dln(A) : AEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGTPVNLAVLKLSE 
         :                                                                                                                          
 3dp4(A) : AEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGTPVNLAVLKLSE 
           __________________________________________________________________________________________216___________________________ 

           _____251__________                                                                                                       
 3dln(A) : QGILDKLKNKWWYDKGEC                                                                                                       
         :                                                                                                                          
 3dp4(A) : QGILDKLKNKWWYDKGEC                                                                                                       
           _____251__________                                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		2.1
Translation
(A) 		0.1
Closure
(%) 		81.4
Bending Residues
( green ) 		  110 - 111
  216 - 217
  251 - 254
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download