Glutamate Receptor 2, Linker, Glutamate Receptor 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor 2, Linker, Glutamate Receptor 2
  Conformer 1
(PDB) 		3tza (A)
  Conformer 2
(PDB) 		5oew (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 150 0.38   3 - 108   213 - 256
2 104 0.46   109 - 212

Sequence


           __________________________________________________________________________________________________________106___________ 
 3tza(A) : *ANKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTP 
         :                                                                                                                          
 5oew(A) : GANKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTP 
           __________________________________________________________________________________________________________109___________ 

           ____________________________________________________________________________________________212_________________________ 
 3tza(A) : IESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLK 
         :                                                                                                                          
 5oew(A) : IESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLK 
           ____________________________________________________________________________________________215_________________________ 

           ______________________                                                                                                   
 3tza(A) : LNEQGLLDKLKNKWWYDKGECG                                                                                                   
         :                                                                                                                          
 5oew(A) : LNEQGLLDKLKNKWWYDKGEC*                                                                                                   
           ______________________                                                                                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		11.3
Translation
(A) 		0.3
Closure
(%) 		97.5
Bending Residues
( green ) 		  106 - 109
  212 - 214
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download