Peptidyl-Prolyl Cis-Trans Isomerase Slyd

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Peptidyl-Prolyl Cis-Trans Isomerase Slyd
  Conformer 1
(PDB) 		4odk (A)
  Conformer 2
(PDB) 		4odm (C)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 80 0.43   3 - 17   24 - 64   125 - 148
2 63 0.69   18 - 23   65 - 124

Sequence


           ______________16_____23_______________________________________64________________________________________________________ 
 4odk(A) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQD---nPMPLTVVAVEGEEVTVDFNHP 
         :                                                                                                                          
 4odm(C) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP 
           ______________16_____23_______________________________________64________________________________________________________ 

           _124________________________________                                                                                     
 4odk(A) : LAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHH                                                                                     
         :                                                                                                                          
 4odm(C) : LAGKDLDFQVEVVKVREATPEELLHGHAHLVPK***                                                                                     
           _124________________________________                                                                                     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.2
Translation
(A) 		-0.4
Closure
(%) 		17.1
Bending Residues
( green ) 		  16 - 20
  23 - 26
  64 - 65
  124 - 125
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download