Redox-Sensing Transcriptional Repressor Rex

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Redox-Sensing Transcriptional Repressor Rex
  Conformer 1
(PDB) 		3keq (A)
  Conformer 2
(PDB) 		3keq (B)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 108 1.04   84 - 193
2 64 0.69   10 - 80

Sequence


           ______________________________________________________________________77________________________________________________ 
 3keq(A) : SIPKATAKRLSLYYRIFKRFNTDGIEKASSKQIADALGIDSATVRRDFSYFGE-------yDVKKLMNFFAEILN---tTNVMLVGCGNIGRALLHYRFHDRNKMQISMAFDLDSNDLVG 
         :                                                                                                                          
 3keq(B) : SIPKATAKRLSLYYRIFKRFNTDGIEKASSKQIADALGIDSATVRRDFSYFGELGRRGFGYDVKKLMNFFAEILNDHSTTNVMLVGCGNIGRALLHYRFHDRNKMQISMAFDLDSNDLVG 
           ______________________________________________________________________77________________________________________________ 

           ______________________________________________________________________________________                                   
 3keq(A) : KTTEDGIPVYGISTINDHLIDSDIETAILTVPSTEAQEVADILVKAGIKGILSFSPVHLTLPKDIIVQYVDLTSELQTLLYFMNQQ                                   
         :                                                                                                                          
 3keq(B) : KTTEDGIPVYGISTINDHL--sDIETAILTVPSTEAQEVADILVKAGIKGILSFSPVHLTLPKDIIVQYVDLTSELQTLLYFMNQQ                                   
           ______________________________________________________________________________________                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.5
Translation
(A) 		0.5
Closure
(%) 		1.3
Bending Residues
( green ) 		  77 - 84
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download