Riboflavin Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Riboflavin Kinase
  Conformer 1
(PDB) 		2vbt (A)
  Conformer 2
(PDB) 		2vbv (A)
  Window Length 13
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 102 0.66   7 - 59   80 - 128
2 20 0.84   60 - 79

Sequence


           ________________________________________________________58___________________79_________________________________________ 
 2vbt(A) : MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNL 
         :                                                                                                                          
 2vbv(A) : MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNL 
           ________________________________________________________58___________________79_________________________________________ 

           ________________                                                                                                         
 2vbt(A) : KDGDVIKILIKGDKDE                                                                                                         
         :                                                                                                                          
 2vbv(A) : KDGDVIKILIKGDK**                                                                                                         
           ________________                                                                                                         

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		11.2
Translation
(A) 		-0.1
Closure
(%) 		0.8
Bending Residues
( green ) 		  58 - 60
  79 - 80
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download