Ump-Cmp Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ump-Cmp Kinase
  Conformer 1
(PDB) 		1tev (A)
  Conformer 2
(PDB) 		3ukd (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 141 1.61   5 - 42   66 - 136   157 - 193
2 22 1.09   43 - 65
3 20 2.42   137 - 156

Sequence


           _______________________________________41_____________________64________________________________________________________ 
 1tev(A) : **PLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFF 
         :                                                                                                                          
 3ukd(A) : SKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQS-GSKDGEMIATMIKNGEIVPSIVTVKLLKNAID----ANQGKN-FLVDGFPRNEENNNSWEENMKDFVDTKFVLFF 
           _______________________________________44_____________________66________________________________________________________ 

           ___________134___________________156_________________________________________                                            
 1tev(A) : DCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKEG*                                            
         :                                                                                                                          
 3ukd(A) : DCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSMGF                                            
           ___________131___________________153_________________________________________                                            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		62.7
Translation
(A) 		-1.1
Closure
(%) 		92.9
Bending Residues
( green ) 		  41 - 46
  64 - 67
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		20.8
Translation
(A) 		1.8
Closure
(%) 		98.3
Bending Residues
( green ) 		  134 - 137
  156 - 159
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download