Iron-Dependent Repressor Ider

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Iron-Dependent Repressor Ider
  Conformer 1
(PDB) 		2isz (B)
  Conformer 2
(PDB) 		1fx7 (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 91 0.5   3 - 26   72 - 138
2 45 0.5   27 - 71

Sequence


           ________________________26___________________________________________71_________________________________________________ 
 2isz(B) : MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVL 
         :                                                                                                                          
 1fx7(D) : MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVL 
           ________________________26___________________________________________71_________________________________________________ 

           ____________________________________________________________________________________________________                     
 2isz(B) : NNPTTSPFGNPIPGLVELGV********************************************************************************                     
         :                                                                                                                          
 1fx7(D) : NNPTTSPFGNPIPGLDELGVlVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV                     
           ____________________________________________________________________________________________________                     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.5
Translation
(A) 		0.2
Closure
(%) 		7.6
Bending Residues
( green ) 		  26 - 27
  71 - 73
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download