Epidermal Growth Factor Receptor

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Epidermal Growth Factor Receptor
  Conformer 1
(PDB)
1m17 (A)
  Conformer 2
(PDB)
4i1z (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 62 1.53   680 - 725   753 - 768
2 20 1.32   726 - 745
3 200 0.75   746 - 752   769 - 961

Sequence


           _________________________________________________723___________________745___751______________768_______________________ 
 1m17(A) : GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLL 
         :                                                                                                                          
 4i1z(A) : *****QALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLL 
           _________________________________________________747___________________769___775______________792_______________________ 

           ________________________________________________________________________________________________________________________ 
 1m17(A) : NWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ 
         :                                                                                                                          
 4i1z(A) : NWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ 
           ________________________________________________________________________________________________________________________ 

           ________________________________________________________________________                                                 
 1m17(A) : PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHlMDEEDMDDVVDADEYLIP                                                 
         :                                                                                                                          
 4i1z(A) : PPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERM********************                                                 
           ________________________________________________________________________                                                 

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 38.1 -0.6 95.6   723 - 726 Bending Region Analysis
1 3 34.3 0.1 93.3   751 - 753   768 - 772 Bending Region Analysis
3 2 37.0 -1.5 10.7   745 - 748 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download