Erythropoietin Receptor

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Erythropoietin Receptor
  Conformer 1
(PDB) 		1eer (B)
  Conformer 2
(PDB) 		1cn4 (A)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 122 1.12   11 - 119   200 - 212
2 85 1.5   120 - 199   213 - 217

Sequence


           ______________________________________________________________________________________________________________119_______ 
 1eer(B) : *DPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGQYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVG 
         :                                                                                                                          
 1cn4(A) : PDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGQYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVG 
           ______________________________________________________________________________________________________________119_______ 

           ______________________________________________________________________199__________212___________                        
 1eer(B) : LVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGQGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSEWSEPVSLLT***                        
         :                                                                                                                          
 1cn4(A) : LVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGQGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSEWSEPVSLLTPSD                        
           ______________________________________________________________________199__________212___________                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		17.0
Translation
(A) 		0.4
Closure
(%) 		99.9
Bending Residues
( green ) 		  119 - 120
  199 - 200
  212 - 213
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download