Gluconate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Gluconate Kinase
  Conformer 1
(PDB) 		1knq (A)
  Conformer 2
(PDB) 		1ko5 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 107 0.51   6 - 33   73 - 112   133 - 171
2 31 0.45   38 - 68
3 20 0.84   113 - 132

Sequence


           _____________________________33_________________________________68_________________________________________112__________ 
 1knq(A) : TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLK 
         :                                                                                                                          
 1ko5(A) : TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLK 
           _____________________________33_________________________________68_________________________________________112__________ 

           _______132__________________________________________                                                                     
 1knq(A) : ARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKK*                                                                     
         :                                                                                                                          
 1ko5(A) : ARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKG                                                                     
           _______132__________________________________________                                                                     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		14.7
Translation
(A) 		0.5
Closure
(%) 		88.1
Bending Residues
( green ) 		  33 - 38
  68 - 73
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		8.9
Translation
(A) 		0.4
Closure
(%) 		0.6
Bending Residues
( green ) 		  112 - 113
  132 - 133
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download