Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB) 		3s2v (B)
  Conformer 2
(PDB) 		2f36 (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 138 0.61   7 - 107   214 - 250
2 106 0.63   108 - 213

Sequence


           ______________________________________________________________________________________________________105_______________ 
 3s2v(B) : GANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPI 
         :                                                                                                                          
 2f36(D) : ****TLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPI 
           ______________________________________________________________________________________________________105_______________ 

           _______________________________________________________________________________________210______________________________ 
 3s2v(B) : DSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEE 
         :                                                                                                                          
 2f36(D) : DSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEE 
           _______________________________________________________________________________________210______________________________ 

           _________________                                                                                                        
 3s2v(B) : GKLHMMKEKWWRGNGCP                                                                                                        
         :                                                                                                                          
 2f36(D) : GKLHMMKEKWWR*****                                                                                                        
           _________________                                                                                                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		35.2
Translation
(A) 		-0.3
Closure
(%) 		99.6
Bending Residues
( green ) 		  105 - 110
  210 - 215
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download