Endo-1,4-Beta-Xylanase A

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Endo-1,4-Beta-Xylanase A
  Conformer 1
(PDB) 		2dcy (B)
  Conformer 2
(PDB) 		2qz3 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 145 0.4   5 - 9   22 - 30   38 - 58   66 - 170   179 - 183
2 34 0.57   10 - 21   31 - 37   59 - 65   171 - 178

Sequence


           ________9__________21_______30_____37___________________58_____65_______________________________________________________ 
 2dcy(B) : ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDG 
         :                                                                                                                          
 2qz3(A) : *STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDG 
           ________9__________21_______30_____37___________________58_____65_______________________________________________________ 

           _______________________________________________170_____178_______                                                        
 2dcy(B) : DRTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW                                                        
         :                                                                                                                          
 2qz3(A) : DRTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQVMATAGYQSSGSSNVTVW                                                        
           _______________________________________________170_____178_______                                                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		5.5
Translation
(A) 		-0.1
Closure
(%) 		78.5
Bending Residues
( green ) 		  9 - 10
  21 - 23
  30 - 31
  37 - 38
  58 - 60
  65 - 66
  170 - 171
  178 - 179
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download