Glutamate Receptor Subunit 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor Subunit 2
  Conformer 1
(PDB) 		1tt1 (A)
  Conformer 2
(PDB) 		1txf (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 143 0.49   7 - 105   108 - 110   210 - 251
2 101 0.51   106 - 107   111 - 209

Sequence


           ____________________________________________________________________________________________________105__110____________ 
 1tt1(A) : NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPID 
         :                                                                                                                          
 1txf(A) : **TLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQND-KGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPID 
           ____________________________________________________________________________________________________104__109____________ 

           ____________________________________________________________________________________209_________________________________ 
 1tt1(A) : SADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEG 
         :                                                                                                                          
 1txf(A) : SADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEG 
           ____________________________________________________________________________________208_________________________________ 

           ___________                                                                                                              
 1tt1(A) : KLHMMKEKWWR                                                                                                              
         :                                                                                                                          
 1txf(A) : KLHMMKEKWWR                                                                                                              
           ___________                                                                                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.3
Translation
(A) 		0.4
Closure
(%) 		77.4
Bending Residues
( green ) 		  105 - 108
  110 - 111
  209 - 210
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download