Glutamate Receptor Subunit 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor Subunit 2
  Conformer 1
(PDB) 		1tt1 (A)
  Conformer 2
(PDB) 		1s50 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 129 0.46   106 - 216   228 - 244   251 - 251
2 118 0.56   5 - 105   217 - 227   245 - 250

Sequence


           _____________________________________________________________________________________________________105________________ 
 1tt1(A) : *NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPI 
         :                                                                                                                          
 1s50(A) : SNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPI 
           _____________________________________________________________________________________________________105________________ 

           ____________________________________________________________________________________________216________227______________ 
 1tt1(A) : DSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEE 
         :                                                                                                                          
 1s50(A) : DSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEE 
           ____________________________________________________________________________________________216________227______________ 

           244___250_________                                                                                                       
 1tt1(A) : GKLHMMKEKWWR******                                                                                                       
         :                                                                                                                          
 1s50(A) : GKLHMMKEKWWRGNGCPE                                                                                                       
           244___250_________                                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		5.9
Translation
(A) 		0.0
Closure
(%) 		78.8
Bending Residues
( green ) 		  105 - 106
  216 - 217
  227 - 229
  244 - 245
  250 - 251
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download