Glutamate Receptor Subunit 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor Subunit 2
  Conformer 1
(PDB) 		1ycj (A)
  Conformer 2
(PDB) 		4e0x (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 132 0.66   434 - 532   765 - 797
2 112 0.74   533 - 764

Sequence


           _____________________________________________________________________________________________________532________________ 
 1ycj(A) : GANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPI 
         :                                                                                                                          
 4e0x(A) : ***RTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPI 
           _____________________________________________________________________________________________________104________________ 

           _____________________________________________________________________________________________764________________________ 
 1ycj(A) : DSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEE 
         :                                                                                                                          
 4e0x(A) : DSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEE 
           _____________________________________________________________________________________________216________________________ 

           ____________                                                                                                             
 1ycj(A) : GKLHMMKEKWW*                                                                                                             
         :                                                                                                                          
 4e0x(A) : GKLHMMKEKWWR                                                                                                             
           ____________                                                                                                             

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.4
Translation
(A) 		0.0
Closure
(%) 		95.6
Bending Residues
( green ) 		  532 - 533
  764 - 765
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download