Iron-Uptake System-Binding Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Iron-Uptake System-Binding Protein
  Conformer 1
(PDB) 		2why (A)
  Conformer 2
(PDB) 		2phz (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 21 0.64   151 - 169   171 - 172
2 123 0.48   22 - 150
3 122 0.55   170 - 170   173 - 294

Sequence


           ________________________________________________________________________________________________________________________ 
 2why(A) : KKKIEYLDKTYEVTVPTDKIAITGSVESMEDAKLLDVHPQGAISFSGKFPDMFKDITDKAEPTGEKMEPNIEKILEMKPDVILASTKFPEKTLQKISTAGTTIPVSHISSNWKENMMLLA 
         :                                                                                                                          
 2phz(A) : *KKIEYLDKTYEVTVPTDKIAITGSVES-eDAKLLDVHPQGAISFSGKFPD-fKDITDKAEPTGEK-ePNIEKILE-kPDVILASTKFPEKTLQKISTAGTTIPVSHISSNWKEN--lLA 
           ________________________________________________________________________________________________________________________ 

           _______148__________________169_________________________________________________________________________________________ 
 2why(A) : QLTGKEKKAKKIIADYEQDLKETKTKINDKAKDSKALVIRIRQGNIYIYPEQVYFNSTLYGDLGLKAPNEVKAAKAQELISLEKLSEMNPDHIFVQFSDDENADKPDALKDLEKNPIWKS 
         :                                                                                                                          
 2phz(A) : QLTGKEKKAKKIIADYEQDLKEIKTKINDKAKDSKALVIRIRQGNIYIYPEQVYFNSTLYGDLGLKAPNEVKAAKAQELSSLEKLSE-nPDHIFVQFSDDENADKPDALKDLEKNPIWKS 
           _______148__________________169_________________________________________________________________________________________ 

           ___________________________________________                                                                              
 2why(A) : LKAVKEDHVYVNSVDPLAQGGTAWSKVRFLKAAAEKLTQNKLA                                                                              
         :                                                                                                                          
 2phz(A) : LKAVKEDHVYVNSVDPLAQGGTAWSKVRFLKAAAEKLT*****                                                                              
           ___________________________________________                                                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		20.6
Translation
(A) 		0.1
Closure
(%) 		33.1
Bending Residues
( green ) 		  148 - 151
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		9.3
Translation
(A) 		-0.7
Closure
(%) 		35.4
Bending Residues
( green ) 		  169 - 173
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download