P58-Cl42 Kir

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name P58-Cl42 Kir
  Conformer 1
(PDB) 		2dli (A)
  Conformer 2
(PDB) 		2dla (A)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 47 12.69   109 - 155
2 36 9.41   73 - 108

Sequence


           ___________________________________________________________________________________________________106__________________ 
 2dli(A) : HRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESV 
         :                                                                                                                          
 2dla(A) : ***********************************MMIMLDPFSEKAKELLKGFGSINDFMDAIPKIVSVDDVIERIRVVKNEKLIDKFLDQDNVMDLAQFYALLGALSYSPYGIELELV 
           ____________________________________________________________________________________________________67__________________ 

           ________________________________________________________________________________________________________________________ 
 2dli(A) : TLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVI******************************************** 
         :                                                                                                                          
 2dla(A) : KKANLIIYSERLKRKKEIKPEEISIDVSTAIEFPTEDVRKIERVYGKIPEYTMKISDFLDLVPDEKLANYYIYEGRVYLKREDLIRIWSKAFERNVERGVNMLYEIRDELPEFYRKVLGE 
           ________________________________________________________________________________________________________________________ 

           _________________                                                                                                        
 2dli(A) : *****************                                                                                                        
         :                                                                                                                          
 2dla(A) : IQAFAEEEFGRKFGEIQ                                                                                                        
           _________________                                                                                                        

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		161.3
Translation
(A) 		-18.4
Closure
(%) 		96.4
Bending Residues
( green ) 		  106 - 109
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download