Proto-Oncogene Cbl

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Proto-Oncogene Cbl
  Conformer 1
(PDB) 		2cbl (A)
  Conformer 2
(PDB) 		1b47 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 219 0.8   52 - 260   270 - 272   295 - 301
2 78 0.52   261 - 269   273 - 294   302 - 348

Sequence


           ________________________________________________________________________________________________________________________ 
 2cbl(A) : PPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELK 
         :                                                                                                                          
 1b47(A) : PPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELK 
           ________________________________________________________________________________________________________________________ 

           _________________________________________________________________________________________258________269_________________ 
 2cbl(A) : GIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIH 
         :                                                                                                                          
 1b47(A) : GIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIH 
           _________________________________________________________________________________________258________269_________________ 

           _____294____301__________________________________________________                                                        
 2cbl(A) : KPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTG                                                        
         :                                                                                                                          
 1b47(A) : KPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLT*                                                        
           _____294____301__________________________________________________                                                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		16.2
Translation
(A) 		0.5
Closure
(%) 		65.4
Bending Residues
( green ) 		  258 - 263
  269 - 273
  294 - 298
  301 - 302
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download