Beta-Phosphoglucomutase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Beta-Phosphoglucomutase
  Conformer 1
(PDB)
2wf5 (A)
  Conformer 2
(PDB)
6h8y (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 145 0.68   3 - 14   84 - 216
2 48 0.69   16 - 63
3 20 0.32   64 - 83

Sequence


           __________12_________________________________________________63__________________83_____________________________________ 
 2wf5(A) : MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGP 
         :                                                                                                                          
 6h8y(A) : MFKAVLFDLDGVITDAAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGP 
           __________12_________________________________________________63__________________83_____________________________________ 

           __________________________________________________________________________________________________                       
 2wf5(A) : FLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ                       
         :                                                                                                                          
 6h8y(A) : FLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ                       
           __________________________________________________________________________________________________                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 26.3 1.4 76.3   12 - 17 Bending Region Analysis
1 3 18.2 1.0 42.6   83 - 93 Bending Region Analysis
2 3 8.4 0.2 23.4   63 - 65 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 2 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 2

Movement classification: Hinge

GLUTATHIONE S-TRANSFERASE

PyMOL Script

Download and extract PyMOL PML script file Download