Trna Endonuclease

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Trna Endonuclease
  Conformer 1
(PDB) 		1a79 (A)
  Conformer 2
(PDB) 		1a79 (B)
  Window Length 13
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 50 0.69   94 - 95   104 - 108   131 - 173
2 87 0.6   15 - 93   96 - 103
3 20 0.93   111 - 130

Sequence


           ___________________________________________________________________________________93_______103__108___________________1 
 1a79(A) : KITGLLDGDRVIVFDKNGISKLSARHYGNVEGNFLSLSLVEALYLINLGWLEVKYKDNKPLSFEELYEYARNVEERLCLKYLVYKDLRTRGYIVKTGLKYGADFRLYERGANIDKEHSVY 
         :                                                                                                                          
 1a79(B) : KITGLLDGDRVIVFDKNGISKLSARHYGNVEGNFLSLSLVEALYLINLGWLEVKYKDNKPLSFEELYEYARNVEERLCLKYLVYKDLRTRGYIVKTGLKYGADFRLYERGANIDKEHSVY 
           ___________________________________________________________________________________93_______103__108___________________1 

           30_________________________________________________                                                                      
 1a79(A) : LVKVFPEDSSFLLSELTGFVRVAHSVRKKLLIAIVDADGDIVYYNMTYVKP                                                                      
         :                                                                                                                          
 1a79(B) : LVKVFPEDSSFLLSELTGFVRVAHSVRKKLLIAIVDADGDIVYYNMTYVKP                                                                      
           30_________________________________________________                                                                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.0
Translation
(A) 		0.2
Closure
(%) 		90.1
Bending Residues
( green ) 		  93 - 96
  103 - 104
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		16.2
Translation
(A) 		0.3
Closure
(%) 		80.4
Bending Residues
( green ) 		  108 - 111
  130 - 131
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download