Apoptosis Regulator Bcl-X

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Apoptosis Regulator Bcl-X
  Conformer 1
(PDB) 		2p1l (A)
  Conformer 2
(PDB) 		1r2d (A)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 107 2.6   86 - 192
2 24 6.15   6 - 85

Sequence


           ____________________________84__________________________________________________________________________________________ 
 2p1l(A) : *SQSNRELVVDFLSYKLSQKGYSWSQ--MAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYL 
         :                                                                                                                          
 1r2d(A) : MSQSNRELVVDFLSYKLSQKGYSWSQFpMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYL 
           ____________________________84__________________________________________________________________________________________ 

           ________________________                                                                                                 
 2p1l(A) : NDHLEPWIQENGGWDTFVELYGNN                                                                                                 
         :                                                                                                                          
 1r2d(A) : NDHLEPWIQENGGWDTFVELYG**                                                                                                 
           ________________________                                                                                                 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		154.0
Translation
(A) 		-0.3
Closure
(%) 		99.7
Bending Residues
( green ) 		  84 - 86
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download