Hypothetical Protein Pa5026

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Hypothetical Protein Pa5026
  Conformer 1
(PDB) 		1sh8 (A)
  Conformer 2
(PDB) 		1sh8 (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 95 0.48   2 - 62   83 - 100   124 - 139
2 49 0.94   63 - 82   101 - 123   140 - 145

Sequence


           ______________________________________________________________62_________________81________________100__________________ 
 1sh8(A) : *HMPLPTELARHLTEEKIAFVQRSGLRAEVLEPGYVRLRMPGAGNENHIGSMYAGALFTLAELPGGALFLTSFDSARFYPIVKEMTLRFRRPAKGDIRVEARLDAERIRQLETEAGERGK 
         :                                                                                                                          
 1sh8(B) : GHMPLPTELARHLTEEKIAFVQRSGLRAEVLEPGYVRLRMPGAGNENHIGSMYAGALFTLAELPGGALFLTSFDSARFYPIVKEMTLRFRRPAKGDIRVEARLDAERIRQLETEAGERGK 
           ______________________________________________________________62_________________81________________100__________________ 

           __123_____________139_____________                                                                                       
 1sh8(A) : AEYSLELQLTDEQGEVVAESAALYQLRSHARPGS                                                                                       
         :                                                                                                                          
 1sh8(B) : AEYSLELQLTDEQGEVVAESAALYQLRSH*****                                                                                       
           __123_____________139_____________                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		13.3
Translation
(A) 		0.4
Closure
(%) 		99.4
Bending Residues
( green ) 		  62 - 63
  81 - 83
  100 - 104
  123 - 124
  139 - 140
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download