Adenylate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Adenylate Kinase
  Conformer 1
(PDB)
4ake (A)
  Conformer 2
(PDB)
3aky  
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 115 1.8   3 - 28   76 - 76   78 - 117   160 - 212
2 23 1.43   29 - 35   61 - 75   77 - 77
3 42 0.83   118 - 159
4 25 0.8   36 - 60

Sequence


           ____________________________28_____35_______________________60_____________75___________________________________________ 
 4ake(A) : **MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQED-CRNGFLLDGFPRTIPQADAM----KEAGINVDYVLEFDVPD 
         :                                                                                                                          
 3aky    : ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDD 
           ____________________________32_____39_______________________64_____________79___________________________________________ 

           _117_____________________________________157___________________________________________________________                  
 4ake(A) : ELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG**                  
         :                                                                                                                          
 3aky    : ELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTG-----IWAGVDASQPPATVWADFLNKLGKN                  
           _126_____________________________________166___________________________________________________________                  

Morph

Jmol._Canvas2D (Jmol) "jmolApplet"[x]
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 21.6 -0.9 87.7   28 - 29   75 - 78 Bending Region Analysis
1 3 46.7 -0.1 98.5   117 - 122   157 - 163 Bending Region Analysis
4 2 43.6 0.4 97.4   35 - 36   60 - 61 Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download