Arno

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Arno
  Conformer 1
(PDB)
1pbv (A)
  Conformer 2
(PDB)
1r8q (E)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 86 0.49   68 - 132   149 - 168   244 - 244
2 27 0.48   133 - 148   169 - 179
3 64 0.61   180 - 243

Sequence


           ______________________________________________________________________________132_____________148_____________164_______ 
 1pbv(A) : ANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRY 
         :                                                                                                                          
 1r8q(E) : ****SKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRY 
           ______________________________________________________________________________132_____________148_____________164_______ 

           __176________________________________________________________________243___                                              
 1pbv(A) : CLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIP                                              
         :                                                                                                                          
 1r8q(E) : CLCNPGVFQSTDTCYVLSYSVIMLNTDLHNPNVRDKMGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIP                                              
           __176________________________________________________________________243___                                              

Morph

Jmol._Canvas2D (Jmol) "jmolApplet"[x]

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 8.6 -0.3 20.3   132 - 133   148 - 149   164 - 169 Bending Region Analysis
1 3 17.9 0.2 71.3   243 - 244 Bending Region Analysis
3 2 10.9 0.3 99.5   176 - 180 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download