Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		5sy1 (C)
  Conformer 2
(PDB) 		4ehq (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 75 1.46   5 - 79
2 66 2.09   80 - 145

Sequence


           __________________________________________________________________________77____________________________________________ 
 5sy1(C) : ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEE 
         :                                                                                                                          
 4ehq(A) : *DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
           __________________________________________________________________________76____________________________________________ 

           ___________________________                                                                                              
 5sy1(C) : VDEMIREADIDGDGQVNYEEFVTMMTS                                                                                              
         :                                                                                                                          
 4ehq(A) : VDEMIREADIDGDGQVNYEEFVQMMT*                                                                                              
           ___________________________                                                                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		163.9
Translation
(A) 		-5.1
Closure
(%) 		96.3
Bending Residues
( green ) 		  77 - 83
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download