Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		5k8q (A)
  Conformer 2
(PDB) 		2l53 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 28 1.55   81 - 100   129 - 136
2 71 4.06   5 - 75
3 37 2.75   101 - 128   137 - 145

Sequence


           _________________________________________________________________________75______________________100____________________ 
 5k8q(A) : *DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMK---sEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
         :                                                                                                                          
 2l53(A) : ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
           _________________________________________________________________________75______________________100____________________ 

           _____128_____136____________                                                                                             
 5k8q(A) : VDEMIREADIDGDGQVNYEEFVQMMTA*                                                                                             
         :                                                                                                                          
 2l53(A) : VDEMIREADIDGDGQVNYEEFVQMMTAK                                                                                             
           _____128_____136____________                                                                                             

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		145.8
Translation
(A) 		-13.1
Closure
(%) 		99.3
Bending Residues
( green ) 		  75 - 81
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		34.3
Translation
(A) 		1.3
Closure
(%) 		96.0
Bending Residues
( green ) 		  100 - 101
  128 - 130
  136 - 137
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download