Adenylate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Adenylate Kinase
  Conformer 1
(PDB) 		1zio  
  Conformer 2
(PDB) 		4ake (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 171 4.72   3 - 29   63 - 211
2 33 1.21   30 - 62

Sequence


           ___________________________29_____________________________60____________________________________________________________ 
 1zio    : MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPLGLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTVAQAEALETMLADIGRKLDYVIHIDVRQDVL 
         :                                                                                                                          
 4ake(A) : MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMK----EAGINVDYVLEFDVPDELI 
           ___________________________29_____________________________60____________________________________________________________ 

           _______________________________________________________________________________________________________                  
 1zio    : MERLTGRRICRNCGATYHLIFHPPAKPGVCDKCGGELYQRADDNEATVANRLEVNMKQMK-PLVDFYEQKGYLRN-----INGEQDMEKVFADIRELLGGLAR                  
         :                                                                                                                          
 4ake(A) : VDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRL-VEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG****                  
           _______________________________________________________________________________________________________                  

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		55.9
Translation
(A) 		1.5
Closure
(%) 		84.8
Bending Residues
( green ) 		  29 - 30
  60 - 63
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download