Adenylate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Adenylate Kinase
  Conformer 1
(PDB) 		2rh5 (B)
  Conformer 2
(PDB) 		2rgx (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 112 1.3   3 - 29   66 - 67   69 - 117   167 - 200
2 37 1.55   30 - 65   68 - 68
3 49 1.29   118 - 166

Sequence


           ___________________________29_________________________________64________________________________________________115_____ 
 2rh5(B) : MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVFPKHGNVIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIER 
         :                                                                                                                          
 2rgx(A) : MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAKEYMERGELVPDDLIIALIEEVFPKHGNVIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVPDEVVIER 
           ___________________________29_________________________________64________________________________________________115_____ 

           ___________________________________________166_____________________________________                                      
 2rh5(B) : LSGRRINPETGEVYHVKYNPPPPGVKVIQREDDKPEVIKKRLEVYREQTAPLIEYYKKKGILRIIDASKPVEEVYRQVLEVI*                                      
         :                                                                                                                          
 2rgx(A) : LSGRRINPETGEVYHVKYNPPPPGVKVIQREDDKPEVIKKRLEVYREQTAPLIEYYKKKGILRIIDASKPVEEVYRQVLEVIG                                      
           ___________________________________________166_____________________________________                                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		36.1
Translation
(A) 		0.7
Closure
(%) 		96.6
Bending Residues
( green ) 		  29 - 30
  64 - 69
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		32.2
Translation
(A) 		2.2
Closure
(%) 		90.6
Bending Residues
( green ) 		  115 - 121
  166 - 167
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download