Beta-Phosphoglucomutase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Beta-Phosphoglucomutase
  Conformer 1
(PDB)
6h93 (B)
  Conformer 2
(PDB)
6hdl (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 63 0.6   16 - 78
2 131 0.56   3 - 14   86 - 114   120 - 122   126 - 137   143 - 217
3 20 0.46   79 - 85   115 - 119   123 - 125   138 - 142

Sequence


           __________12________________________________________________________________78____84___________________________114__119_ 
 6h93(B) : MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGP 
         :                                                                                                                          
 6hdl(A) : MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSKEDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGP 
           __________12________________________________________________________________78____84___________________________114__119_ 

           __125_________137__142_____________________________________________________________________________                      
 6h93(B) : FLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQK                      
         :                                                                                                                          
 6hdl(A) : FLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQK                      
           __125_________137__142_____________________________________________________________________________                      

Morph

Jmol._Canvas2D (Jmol) "jmolApplet"[x]
    jsmol/j2s/core/package.js
-- required by ClazzNode ajax=false async=true

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 20.4 2.0 76.0   12 - 16 Bending Region Analysis
1 3 14.1 0.7 99.8   78 - 79 Bending Region Analysis
2 3 8.3 0.0 90.8   84 - 89   114 - 115   119 - 123   125 - 126   137 - 138   142 - 143 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 2 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 2

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download