Beta-Phosphoglucomutase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Beta-Phosphoglucomutase
  Conformer 1
(PDB) 		6hdf (B)
  Conformer 2
(PDB) 		6hdf (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 111 0.21   9 - 88   97 - 107   121 - 124   127 - 131   201 - 202   207 - 207   210 - 217
2 104 0.18   3 - 8   89 - 96   108 - 120   125 - 126   132 - 200   203 - 206   208 - 209

Sequence


           _______8__________________________________________________________________________84__________96________107__________120 
 6hdf(B) : MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGP 
         :                                                                                                                          
 6hdf(A) : MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGP 
           _______8__________________________________________________________________________84__________96________107__________120 

           _124____131__________________________________________________________________200___206_____________                      
 6hdf(B) : FLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLENSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQK                      
         :                                                                                                                          
 6hdf(A) : FLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLENSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQK                      
           _124____131__________________________________________________________________200___206_____________                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		1.7
Translation
(A) 		0.0
Closure
(%) 		10.1
Bending Residues
( green ) 		  8 - 9
  84 - 89
  96 - 97
  107 - 108
  120 - 121
  124 - 127
  131 - 132
  200 - 203
  206 - 210
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download