B-Raf Proto-Oncogene Serine/threonine-Protein Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name B-Raf Proto-Oncogene Serine/threonine-Protein Kinase
  Conformer 1
(PDB) 		1uwh (A)
  Conformer 2
(PDB) 		3c4c (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 233 1.29   449 - 483   505 - 719
2 21 1.21   484 - 504

Sequence


           __________________________________483__________________504______________________________________________________________ 
 1uwh(A) : DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTAPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYL 
         :                                                                                                                          
 3c4c(A) : DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYL 
           __________________________________484__________________505______________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 1uwh(A) : HAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVlSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKK 
         :                                                                                                                          
 3c4c(A) : HAKSIIHRDLKSNNIFLHEDNTVKIGDFG-----sGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKK 
           ________________________________________________________________________________________________________________________ 

           ________________________                                                                                                 
 1uwh(A) : KRDERPLFPQILASIELLARSLPK                                                                                                 
         :                                                                                                                          
 3c4c(A) : KRDERPSFPRILAEIEELARELS*                                                                                                 
           ________________________                                                                                                 

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		35.7
Translation
(A) 		-0.9
Closure
(%) 		65.3
Bending Residues
( green ) 		  483 - 486
  504 - 505
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download