Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		5k8q (A)
  Conformer 2
(PDB) 		5sy1 (D)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 75 1.35   67 - 144
2 57 0.79   10 - 66

Sequence


           ________________________________________________________________66______________________________________________________ 
 5k8q(A) : *DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMK---sEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
         :                                                                                                                          
 5sy1(D) : ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEE 
           ________________________________________________________________67______________________________________________________ 

           ___________________________                                                                                              
 5k8q(A) : VDEMIREADIDGDGQVNYEEFVQMMTA                                                                                              
         :                                                                                                                          
 5sy1(D) : VDEMIREADIDGDGQVNYEEFVTMMTS                                                                                              
           ___________________________                                                                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.7
Translation
(A) 		0.6
Closure
(%) 		86.0
Bending Residues
( green ) 		  66 - 67
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download