Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		1cll (A)
  Conformer 2
(PDB) 		1k93 (F)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 45 2.27   7 - 28   58 - 60   62 - 81
2 30 1.57   29 - 57   61 - 61
3 64 0.67   82 - 145

Sequence


           _______________________28________________________54____60_________________79____________________________________________ 
 1cll(A) : LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDE 
         :                                                                                                                          
 1k93(F) : *TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDE 
           _______________________28________________________54____60_________________79____________________________________________ 

           ________________________                                                                                                 
 1cll(A) : MIREADIDGDGQVNYEEFVQMMTA                                                                                                 
         :                                                                                                                          
 1k93(F) : MIREADIDGDGQVNYEEFVQMMTA                                                                                                 
           ________________________                                                                                                 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		44.8
Translation
(A) 		2.9
Closure
(%) 		97.6
Bending Residues
( green ) 		  28 - 31
  54 - 58
  60 - 62
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		73.3
Translation
(A) 		2.1
Closure
(%) 		35.2
Bending Residues
( green ) 		  79 - 85
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download