Carbonic Anhydrase 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Carbonic Anhydrase 2
  Conformer 1
(PDB) 		4gl1 (X)
  Conformer 2
(PDB) 		4lp7 (B)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 49 9.39   66 - 107   124 - 131
2 27 10.63   108 - 119   132 - 146

Sequence


           ______________________________________________________________________________________________________107_________119___ 
 4gl1(X) : HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNLGAAFLVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH 
         :                                                                                                                          
 4lp7(B) : ******************************************************MESYLVDTYQGIPYTAAVQVDLIEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQN 
           _______________________________________________________________________________________________________51__________63___ 

           _____131________________________________________________________________________________________________________________ 
 4gl1(X) : WNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVD 
         :                                                                                                                          
 4lp7(B) : GPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSvGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIK-------EqALTQAKIAPYAGLIM 
           ______74________________________________________________________________________________________________________________ 

           ______________________________________________                                                                           
 4gl1(X) : NWRPAQPLKNRQIKASFK****************************                                                                           
         :                                                                                                                          
 4lp7(B) : IMTMNNPKgAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR                                                                           
           ______________________________________________                                                                           

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		130.7
Translation
(A) 		3.8
Closure
(%) 		40.0
Bending Residues
( green ) 		  107 - 108
  119 - 125
  131 - 132
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

Chart image not calculated - the graph is too big to count connection types.

PyMOL Script

Download and extract PyMOL PML script file Download