Carbonic Anhydrase 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Carbonic Anhydrase 2
  Conformer 1
(PDB) 		4gl1 (X)
  Conformer 2
(PDB) 		4lp7 (B)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 49 9.39   66 - 107   124 - 131
2 27 10.63   108 - 119   132 - 146

Sequence


           ______________________________________________________________________________________________________107_________119___ 
 4gl1(X) : HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNLGAAFLVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH 
         :                                                                                                                          
 4lp7(B) : ******************************************************MESYLVDTYQGIPYTAAVQVDLIEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQN 
           _______________________________________________________________________________________________________51__________63___ 

           _____131________________________________________________________________________________________________________________ 
 4gl1(X) : WNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVD 
         :                                                                                                                          
 4lp7(B) : GPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSvGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIK-------EqALTQAKIAPYAGLIM 
           ______74________________________________________________________________________________________________________________ 

           ______________________________________________                                                                           
 4gl1(X) : NWRPAQPLKNRQIKASFK****************************                                                                           
         :                                                                                                                          
 4lp7(B) : IMTMNNPKgAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR                                                                           
           ______________________________________________                                                                           

Morph

Jmol._Canvas2D (Jmol) "jmolApplet"[x]
    jsmol/j2s/core/package.js
-- required by ClazzNode ajax=false async=true
    jsmol/j2s/core/core.z.js
-- required by ClazzNode ajax=false async=true
    jsmol/j2s/J/g3d/PixelatorT.js
-- required by J.g3d.Graphics3D ajax=false async=true
Morph animation in progress.
Status: Progress file not found. You may be seeing this after system maintenance due toan issue with some browsers. Please try closing and reopening your browser, or clearingyour browser's cookies. If this issue persists please contact us.

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		130.7
Translation
(A) 		3.8
Closure
(%) 		40.0
Bending Residues
( green ) 		  107 - 108
  119 - 125
  131 - 132
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

Chart image not calculated - the graph is too big to count connection types.

PyMOL Script

Download and extract PyMOL PML script file Download
Application loaded.