Allograft Inflammatory Factor 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Allograft Inflammatory Factor 1
  Conformer 1
(PDB) 		1wy9 (A)
  Conformer 2
(PDB) 		2d58 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 58 0.82   19 - 64   100 - 111
2 35 1.14   65 - 99

Sequence


           ______________________________________________64_________________________________99____________________________          
 1wy9(A) : KAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEK          
         :                                                                                                                          
 2d58(A) : KAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILM****          
           ______________________________________________64_________________________________99____________________________          

Morph

Jmol._Canvas2D (Jmol) "jmolApplet"[x]
    jsmol/j2s/core/package.js
-- required by ClazzNode ajax=false async=true
    jsmol/j2s/core/core.z.js
-- required by ClazzNode ajax=false async=true
    jsmol/j2s/J/g3d/PixelatorT.js
-- required by J.g3d.Graphics3D ajax=false async=true
Morph animation in progress.
Status: Progress file not found. You may be seeing this after system maintenance due toan issue with some browsers. Please try closing and reopening your browser, or clearingyour browser's cookies. If this issue persists please contact us.

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		21.7
Translation
(A) 		-0.8
Closure
(%) 		95.4
Bending Residues
( green ) 		  64 - 65
  99 - 101
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: missing

PyMOL Script

Download and extract PyMOL PML script file Download
Application loaded.