Allograft Inflammatory Factor 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Allograft Inflammatory Factor 1
  Conformer 1
(PDB) 		1wy9 (A)
  Conformer 2
(PDB) 		2d58 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 58 0.82   19 - 64   100 - 111
2 35 1.14   65 - 99

Sequence


           ______________________________________________64_________________________________99____________________________          
 1wy9(A) : KAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEK          
         :                                                                                                                          
 2d58(A) : KAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILM****          
           ______________________________________________64_________________________________99____________________________          

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		21.7
Translation
(A) 		-0.8
Closure
(%) 		95.4
Bending Residues
( green ) 		  64 - 65
  99 - 101
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download