Cyanoglobin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Cyanoglobin
  Conformer 1
(PDB)
1s69 (A)
  Conformer 2
(PDB)
1rtx (A)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 58 0.59   24 - 34   66 - 81   90 - 120
2 26 1.29   6 - 23   82 - 89

Sequence


           ____________________23________________________________________________________81______89________________________________ 
 1s69(A) : STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAPAHKRDV 
         :                                                                                                                          
 1rtx(A) : STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAPAHKRDV 
           ____________________23________________________________________________________81______89________________________________ 

           ___                                                                                                                      
 1s69(A) : LNQ                                                                                                                      
         :                                                                                                                          
 1rtx(A) : LNQ                                                                                                                      
           ___                                            &